PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G261500.1
Common NamePHAVU_003G261500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 799aa    MW: 89263.2 Da    PI: 6.5171
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G261500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.56.2e-085496347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
  Phvul.003G261500.1 54 AWTRQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 96
                        6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1046101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-54999IPR009057Homeodomain-like
PROSITE profilePS5129313.41650101IPR017884SANT domain
SMARTSM007172.7E-65199IPR001005SANT/Myb domain
CDDcd001678.19E-65497No hitNo description
PfamPF002495.6E-65496IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MEAEAQISHN SSTQFQPEPV VSVQNGDPGV SSYVANAVIP QQPATKKPTR QWAAWTRQEE  60
ESFFTALRQV GKNFEKITSR VQSKNKDQVR HYYYRLVRRM NKLLGPGLCL DAKNSKDTNA  120
AMLRWWSLLE KYSCKASKLH LKPRRFKIFL EALEHQLLKD RKKNVRKRPL QGGNCLPPLP  180
STVSNQSRAS GNEARAVKLV LVDSQNILKL GPSKSSMKRN INMGVSRSNT KGDSNAIKST  240
RQRKKSGMIS TAAYKKWEKA AIAGVSLVAD AAEHLERAAT VREIEQDQEN PGEKCFDPTD  300
YVLPSLPTCP QNQFVDNNVN NMKLKLQLFP IDEPTRRALE VDKHNPHLEL TLSTRKKISS  360
ILEHLNRKWG HSSIAVGELM LFPYGIQREN LVNYQRWTQE SILSAADIYA MIGSPPIFRL  420
RYGWFSNTEL GLLNMQVTVA SGSMLTQSKS SVYSKDRIMN SVSFPTPSTN SHSLELSEDC  480
RISMNRNHTL MTSSPDVPNT RGNNAHPNTS SEESRRPTAN SLWHEKDVRD GAVTTQLEDL  540
DELKLSSGTG QSAGEWADSL TNISVGDLLS GVSQDLEDDC INPPIAENCH DIQQIPFSSD  600
SFDAAIAAHI SRHQDKMGQS SLAAHMSSIW DAEETCDAFL FRKDPILHVD RPCLSPVASL  660
ESENKVPERS FEKLDEFSPE RERLVEDFVQ SDPLPMDNSS ESDADIQDHL GKDFTALTDI  720
YWPDSLGPLD LDIPSSTKYH TEDLIFSDSL SGLNRLIASS LDAFQNCSFF GFDKKEAPST  780
VEARESATLS DFKIESGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156135.10.0hypothetical protein PHAVU_003G261500g
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLV7CDB10.0V7CDB1_PHAVU; Uncharacterized protein
STRINGGLYMA16G23840.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98832531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.10.0TSL-kinase interacting protein 1